PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000229498
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 497aa    MW: 56806.3 Da    PI: 8.2449
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000229498genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding521.6e-16163211148
                      TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+W++eEd +l+++++++G+g +W + +++ g++R++k+c++rw++yl
    MDP0000229498 163 KGPWSPEEDSKLKEYIEKYGTGgNWIALPQKAGLKRCGKSCRLRWLNYL 211
                      79*********************************************97 PP

2Myb_DNA-binding39.71.1e-12218260246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g ++ eEd ++  +++  G++ W+ Ia+ ++ gRt++++k++w++
    MDP0000229498 218 GEFSDEEDRIICSLFASIGSR-WSVIAAQLP-GRTDNDIKNYWNT 260
                      789******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.788158211IPR017930Myb domain
SuperFamilySSF466892.94E-27160258IPR009057Homeodomain-like
SMARTSM007174.3E-13162213IPR001005SANT/Myb domain
PfamPF002491.2E-15163211IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-24164218IPR009057Homeodomain-like
CDDcd001674.43E-9165211No hitNo description
PROSITE profilePS5129421.824212266IPR017930Myb domain
SMARTSM007172.4E-12216264IPR001005SANT/Myb domain
PfamPF002492.0E-11218260IPR001005SANT/Myb domain
CDDcd001674.14E-8219262No hitNo description
Gene3DG3DSA:1.10.10.602.8E-23219266IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 497 aa     Download sequence    Send to blast
MXHRQSKEVV STVRAPDQMN LRGIKWWWRL EGSEPYGGHG EETEXDVKQP VAWDRNRSXA  60
TLFSSTTCPT WVIPGGPHSH IPVSEWSGIT WCATLSKPLY TTIIKAYHRP NPKSISKGET  120
FGSSIEFRSY PRDLKRDFSP TERERERERW GGAPCCDKAN VKKGPWSPEE DSKLKEYIEK  180
YGTGGNWIAL PQKAGLKRCG KSCRLRWLNY LRPNIKHGEF SDEEDRIICS LFASIGSRWS  240
VIAAQLPGRT DNDIKNYWNT KLKKKLMGMH MGPPRPHNHH KNLLKPPPFP SSSHHNYQNQ  300
PLIPSEPLSS LYKDLSNYNR SFLGFEAPVP LPPQVSLTSN NFSNISTNSS IFQTLNYPAG  360
VKENNNNNNL LVFGSEGSCS TSSDGSCNNQ ISYDYCSRSE INNIKQEEMG FDHQGFMMLN  420
YGNQWTERPN GFYFGSENNT LEFTDLDEDV KQQLISTRSK NNYNNNTIIN ESSKSNSXLF  480
NVNESKTEDD EKVMYFY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-241632667108B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.159890.0fruit
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ0744720.0DQ074472.1 Malus x domestica MYB24 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008359941.10.0PREDICTED: transcription factor RAX1-like
TrEMBLQ2LME00.0Q2LME0_MALDO; MYB24
STRINGPOPTR_0009s01270.11e-109(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13034340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.12e-69myb domain protein 36